PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00023.1.g00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 492aa    MW: 53125.8 Da    PI: 5.6323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00023.1.g00270.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.6e-153885148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+ Ed  lvd v+++G g+W+++ r+  + R++k+c++rw ++l
  Zmw_sc00023.1.g00270.1.am.mk 38 KGPWTAAEDAMLVDHVRRHGEGNWNAVQRMTALLRCGKSCRLRWTNHL 85
                                  79******************************99***********996 PP

2Myb_DNA-binding24.65.9e-0891121132
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg 32 
                                   +g++T++E+ l++++++qlG++ W++ a+++ 
  Zmw_sc00023.1.g00270.1.am.mk  91 KGAFTPDEEFLIAQLHAQLGNK-WARMAAHVS 121
                                   799*******************.*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.7393389IPR017930Myb domain
SMARTSM007171.4E-133787IPR001005SANT/Myb domain
PfamPF002494.9E-133885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-203992IPR009057Homeodomain-like
SuperFamilySSF466891.02E-2239115IPR009057Homeodomain-like
CDDcd001671.17E-104085No hitNo description
PROSITE profilePS500907.13186176IPR017877Myb-like domain
SMARTSM007171.2E-590178IPR001005SANT/Myb domain
PfamPF002497.5E-791122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-1993122IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-19163179IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MANNHGAAPT SPDEEKVAGE GRVEQEEAVP AVLAGLKKGP WTAAEDAMLV DHVRRHGEGN  60
WNAVQRMTAL LRCGKSCRLR WTNHLRPNLR KGAFTPDEEF LIAQLHAQLG NKWARMAAHV  120
STAASRSIPD VFRSNGILFS VVSSRILDDM LSLCCVLPQL PGRTDNEIKN YWNTRTKRRQ  180
RADLPVYPPE VQLQLALSKR CRYDGFSPLA PPQPQLSESS IQTLETGAAA SAGYTSARPA  240
PLDLAQRLAV TTKPTVQFLS PPPFSVPSSP WAKTFARNGR YFQFAHSSPV SPSTPTGPLH  300
PVTPDLSLGY DARGTEQRGL PPLSLSPCPR LELPSNQFSQ PMPPPSASAA AGGFSGGALP  360
DQPNAACLEK MLQELHEAMK VDSPVLVPAN GGPGDAVLER HHGRDDKPEG ELKEDIDTLL  420
DLMIPPFNAE EPAPPAPAPN LSSSISQQSS DDQEPSNVDL EMDLPATGAA SSPDQEWGLD  480
GVCQWSNESR IC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-213617925127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982528.10.0PREDICTED: myb-related protein P-like
TrEMBLC5WUA41e-160C5WUA4_SORBI; Putative uncharacterized protein Sb01g015920
STRINGSb01g015920.11e-159(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750